PTM Viewer PTM Viewer

AT2G03710.1

Arabidopsis thaliana [ath]

K-box region and MADS-box transcription factor family protein

No PTMs currently found

PLAZA: AT2G03710
Gene Family: HOM05D000042
Other Names: AGL3,AGAMOUS-like 3; SEPALLATA 4; SEP4

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

PTMs

There are no stored PTMs for this protein

Sequence

Length: 258

MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEIALLIFSNRGKLYEFCSSPSGMARTVDKYRKHSYATMDPNQSAKDLQDKYQDYLKLKSRVEILQHSQRHLLGEELSEMDVNELEHLERQVDASLRQIRSTKARSMLDQLSDLKTKEEMLLETNRDLRRKLEDSDAALTQSFWGSSAAEQQQQHQQQQQGMSSYQSNPPIQEAGFFKPLQGNVALQMSSHYNHNPANATNSATTSQNVNGFFPGWMV

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR002100 1 61
IPR002487 85 178
IPR033896 2 77

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here